Is investinargylecertifiedpinkdiamonds.pro a scam?
'LIKELY SCAM'
Risk: HIGH
Website Screenshot
Overview
This page exhibits classic pig-butchering red flags, with high daily earning promises, unverifiable user claims, and the use of generic crypto references tied to an 'AI trading' scheme. The lack of real company information, aggressive registration prompts, and claims of massive user traction on an unknown, privacy-shielded domain point to an extremely high scam likelihood.
Why We Think This Is A Scam
Promises of making over $1,108 DAILY trading on news ('Make over $1,108 DAILY trading on news with Invest in Argyle').
Invokes 'AI trading platform' language, a hallmark of pig-butchering schemes ('Trusted AI Trading Platform').
Unverifiable and likely fabricated user statistics to create false credibility ('4.8 stars from over 2,776 users'), especially given the unknown domain creation date.
Encourages immediate registration with minimal details and no fees—a typical entry hook for investment scams.
Suggests easy registration, high profits, and immediate returns to lure targets into funneling funds quickly.
No verifiable company info, registration number, or evidence of regulatory oversight.
Wildcard mention of multiple cryptocurrencies (BTC, Binance, USDT, Bitcoin, Ethereum) to cast a wide net for victims.
Fake sense of legitimacy in the copyright (2026 All Rights Reserved') for a site with no visible history.
Stay Protected
Get real-time protection while browsing. Our Chrome extension helps protect against scams and phishing attacks.
Add to Chrome
Quick Actions
Registration Info
Registrar:—
Registered:—
Hosting Info
Provider:Cloudflare, Inc.
Location:US
Help Others Stay Safe
Get protected and share safety tips with your community. Together, we can make the internet safer.